Lineage for d1hv4h_ (1hv4 H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44247Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries)
  8. 44253Domain d1hv4h_: 1hv4 H: [15578]
    Other proteins in same PDB: d1hv4a_, d1hv4c_, d1hv4e_, d1hv4g_

Details for d1hv4h_

PDB Entry: 1hv4 (more details), 2.8 Å

PDB Description: crystal structure analysis of bar-head goose hemoglobin (deoxy form)

SCOP Domain Sequences for d1hv4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv4h_ a.1.1.2 (H:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus)}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1hv4h_:

Click to download the PDB-style file with coordinates for d1hv4h_.
(The format of our PDB-style files is described here.)

Timeline for d1hv4h_: