Lineage for d3bzka3 (3bzk A:1-324)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016915Fold a.294: Tex N-terminal region-like [158831] (1 superfamily)
    multihelical; irregular array of long and short helices; can be divided into several subdomains
  4. 2016916Superfamily a.294.1: Tex N-terminal region-like [158832] (1 family) (S)
  5. 2016917Family a.294.1.1: Tex N-terminal region-like [158833] (1 protein)
    Pfam PF09371
  6. 2016918Protein Transcriptional accessory factor Tex [158834] (1 species)
  7. 2016919Species Pseudomonas aeruginosa [TaxId:287] [158835] (3 PDB entries)
    Uniprot Q9HTY8 1-324! Uniprot Q9HTY8 2-324
  8. 2016920Domain d3bzka3: 3bzk A:1-324 [155779]
    Other proteins in same PDB: d3bzka1, d3bzka2, d3bzka4, d3bzka5
    automated match to d3bzca3

Details for d3bzka3

PDB Entry: 3bzk (more details), 2.3 Å

PDB Description: crystal structure of the tex protein from pseudomonas aeruginosa, crystal form 2
PDB Compounds: (A:) Tex

SCOPe Domain Sequences for d3bzka3:

Sequence, based on SEQRES records: (download)

>d3bzka3 a.294.1.1 (A:1-324) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
mdsintriaeelsalpsgrvqpqqvaaavalldegstvpfiaryrkevtgslddtqlrml
eerlrylreleerrgailasieeqgkltpelardikladtktrledlylpykqkrrtkgq
ialeaglgaladalfddptlvpeseaarfvdaekgfadvkavlegakyilmerfaedatl
ldklrvfmkneatltarvvpgkeqegakfsdyfehdeplksapshralaifrgrnegvls
aslkvgeeapgtlhpcevmiaerfglsnqgraadkwlaevvrwtwkvklythletdlfge
lrdgaedeaisvfarnlhdlllaa

Sequence, based on observed residues (ATOM records): (download)

>d3bzka3 a.294.1.1 (A:1-324) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
mdsintriaeelsalpsgrvqpqqvaaavalldegstvpfiaryrkevtgslddtqlrml
eerlrylreleerrgailasieeqgkltpelardikladtktrledlylpykqkrrtkgq
ialeaglgaladalfddptlvpeseaarfvdaekgfadvkavlegakyilmerfaedatl
ldklrvfmkneatltarvvpgkeqegakfsdyfehdeplksapshralaifrgrnegvls
aslkvgapgtlhpcevmiaerfglsnqgraadkwlaevvrwtwkvklythletdlfgelr
dgaedeaisvfarnlhdlllaa

SCOPe Domain Coordinates for d3bzka3:

Click to download the PDB-style file with coordinates for d3bzka3.
(The format of our PDB-style files is described here.)

Timeline for d3bzka3: