SCOPe 2.07: Domain d3bzka2: 3bzk A:564-636

Lineage for d3bzka2 (3bzk A:564-636)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.6: Tex HhH-containing domain-like [158531] (1 protein)
   tandem repeat of two Ruva_2-like domains

6. Protein Transcriptional accessory factor Tex [158532] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [158533] (3 PDB entries)
   Uniprot Q9HTY8 474-563! Uniprot Q9HTY8 564-636

8. Domain d3bzka2: 3bzk A:564-636 [155778]
   Other proteins in same PDB: d3bzka3, d3bzka4, d3bzka5
   automated match to d3bzca2

Details for d3bzka2

PDB Entry: 3bzk, 2.3 Å

PDB Description: crystal structure of the tex protein from pseudomonas aeruginosa, crystal form 2

PDB Compounds: (A:) Tex

SCOPe Domain Sequences for d3bzka2:

Sequence; same for both SEQRES and ATOM records:

>d3bzka2 a.60.2.6 (A:564-636) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
dnpldasavhpetyplvqriaadterdirsligdsaflkrldpkkftdetfglptvtdil
keldkpgrdprpe

Timeline for d3bzka2:

• d3bzka2 first appeared in SCOP 1.75
  
• d3bzka2 appears in SCOPe 2.06
  
• d3bzka2 appears in the current release, SCOPe 2.08