![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.6: Tex HhH-containing domain-like [158531] (1 protein) tandem repeat of two Ruva_2-like domains |
![]() | Protein Transcriptional accessory factor Tex [158532] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [158533] (3 PDB entries) Uniprot Q9HTY8 474-563! Uniprot Q9HTY8 564-636 |
![]() | Domain d3bzka2: 3bzk A:564-636 [155778] Other proteins in same PDB: d3bzka3, d3bzka4, d3bzka5 automated match to d3bzca2 |
PDB Entry: 3bzk (more details), 2.3 Å
SCOPe Domain Sequences for d3bzka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzka2 a.60.2.6 (A:564-636) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} dnpldasavhpetyplvqriaadterdirsligdsaflkrldpkkftdetfglptvtdil keldkpgrdprpe
Timeline for d3bzka2:
![]() Domains from same chain: (mouse over for more information) d3bzka1, d3bzka3, d3bzka4, d3bzka5 |