Lineage for d3bzka1 (3bzk A:474-563)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001286Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2001370Family a.60.2.6: Tex HhH-containing domain-like [158531] (1 protein)
    tandem repeat of two Ruva_2-like domains
  6. 2001371Protein Transcriptional accessory factor Tex [158532] (1 species)
  7. 2001372Species Pseudomonas aeruginosa [TaxId:287] [158533] (3 PDB entries)
    Uniprot Q9HTY8 474-563! Uniprot Q9HTY8 564-636
  8. 2001373Domain d3bzka1: 3bzk A:474-563 [155777]
    Other proteins in same PDB: d3bzka3, d3bzka4, d3bzka5
    automated match to d3bzca1

Details for d3bzka1

PDB Entry: 3bzk (more details), 2.3 Å

PDB Description: crystal structure of the tex protein from pseudomonas aeruginosa, crystal form 2
PDB Compounds: (A:) Tex

SCOPe Domain Sequences for d3bzka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
yqhdvsqlklarsldavvedcvnavgvdvntasaallarisglnstlaqnivahrdanga
frtrdelkkvsrlgektfeqaagflrvmng

SCOPe Domain Coordinates for d3bzka1:

Click to download the PDB-style file with coordinates for d3bzka1.
(The format of our PDB-style files is described here.)

Timeline for d3bzka1: