| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
| Family a.60.2.6: Tex HhH-containing domain-like [158531] (1 protein) tandem repeat of two Ruva_2-like domains |
| Protein Transcriptional accessory factor Tex [158532] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [158533] (3 PDB entries) Uniprot Q9HTY8 474-563! Uniprot Q9HTY8 564-636 |
| Domain d3bzka1: 3bzk A:474-563 [155777] Other proteins in same PDB: d3bzka3, d3bzka4, d3bzka5 automated match to d3bzca1 |
PDB Entry: 3bzk (more details), 2.3 Å
SCOPe Domain Sequences for d3bzka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
yqhdvsqlklarsldavvedcvnavgvdvntasaallarisglnstlaqnivahrdanga
frtrdelkkvsrlgektfeqaagflrvmng
Timeline for d3bzka1:
View in 3DDomains from same chain: (mouse over for more information) d3bzka2, d3bzka3, d3bzka4, d3bzka5 |