Lineage for d3bzia2 (3bzi A:501-593)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239931Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2239932Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2239944Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 2239945Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 2239946Species Human (Homo sapiens) [TaxId:9606] [102858] (23 PDB entries)
  8. 2239988Domain d3bzia2: 3bzi A:501-593 [155776]
    automatically matched to d1umwa2
    complexed with fmt

Details for d3bzia2

PDB Entry: 3bzi (more details), 2.1 Å

PDB Description: Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d3bzia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzia2 d.223.1.2 (A:501-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr
tyrlslleeygcckelasrlryartmvdkllss

SCOPe Domain Coordinates for d3bzia2:

Click to download the PDB-style file with coordinates for d3bzia2.
(The format of our PDB-style files is described here.)

Timeline for d3bzia2: