SCOPe 2.08: Domain d3bzfc2: 3bzf C:2-181

Lineage for d3bzfc2 (3bzf C:2-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)

8. Domain d3bzfc2: 3bzf C:2-181 [155773]
   Other proteins in same PDB: d3bzfa1, d3bzfb_, d3bzfc1, d3bzfd_
   automatically matched to d1mhea2

Details for d3bzfc2

PDB Entry: 3bzf, 2.5 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E

PDB Compounds: (C:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d3bzfc2:

Sequence; same for both SEQRES and ATOM records:

>d3bzfc2 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

Timeline for d3bzfc2:

• d3bzfc2 first appeared in SCOP 1.75
  
• d3bzfc2 appears in SCOPe 2.07