Lineage for d3bzfa2 (3bzf A:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937974Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 2937975Domain d3bzfa2: 3bzf A:2-181 [155770]
    Other proteins in same PDB: d3bzfa1, d3bzfb_, d3bzfc1, d3bzfd_
    automatically matched to d1mhea2

Details for d3bzfa2

PDB Entry: 3bzf (more details), 2.5 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d3bzfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzfa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d3bzfa2:

Click to download the PDB-style file with coordinates for d3bzfa2.
(The format of our PDB-style files is described here.)

Timeline for d3bzfa2: