Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries) |
Domain d1hv4f_: 1hv4 F: [15577] Other proteins in same PDB: d1hv4a_, d1hv4c_, d1hv4e_, d1hv4g_ complexed with hem |
PDB Entry: 1hv4 (more details), 2.8 Å
SCOPe Domain Sequences for d1hv4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv4f_ a.1.1.2 (F:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak eftpdcqaawqklvrvvahalarkyh
Timeline for d1hv4f_: