Lineage for d1hv4f_ (1hv4 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1716705Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries)
  8. 1716710Domain d1hv4f_: 1hv4 F: [15577]
    Other proteins in same PDB: d1hv4a_, d1hv4c_, d1hv4e_, d1hv4g_
    complexed with hem

Details for d1hv4f_

PDB Entry: 1hv4 (more details), 2.8 Å

PDB Description: crystal structure analysis of bar-head goose hemoglobin (deoxy form)
PDB Compounds: (F:) hemoglobin beta chain

SCOPe Domain Sequences for d1hv4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv4f_ a.1.1.2 (F:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d1hv4f_:

Click to download the PDB-style file with coordinates for d1hv4f_.
(The format of our PDB-style files is described here.)

Timeline for d1hv4f_: