SCOP 1.75: Domain d3bzee2: 3bze E:2-181

Lineage for d3bzee2 (3bze E:2-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)

8. Domain d3bzee2: 3bze E:2-181 [155764]
   Other proteins in same PDB: d3bzea1, d3bzeb1, d3bzec1, d3bzed1, d3bzee1, d3bzef1, d3bzeg1, d3bzeh1
   automatically matched to d1mhea2

Details for d3bzee2

PDB Entry: 3bze, 2.5 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E

PDB Compounds: (E:) HLA class I histocompatibility antigen, alpha chain E

SCOP Domain Sequences for d3bzee2:

Sequence; same for both SEQRES and ATOM records:

>d3bzee2 d.19.1.1 (E:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

Timeline for d3bzee2:

• d3bzee2 is new in SCOP 1.75
  
• d3bzee2 appears in SCOPe 2.01
  
• d3bzee2 appears in the current release, SCOPe 2.08