![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d3bzed2: 3bze D:1-99 [155762] Other proteins in same PDB: d3bzea1, d3bzea2, d3bzeb3, d3bzec1, d3bzec2, d3bzed3, d3bzee1, d3bzee2, d3bzef3, d3bzeg1, d3bzeg2, d3bzeh3 automated match to d1a9bb_ |
PDB Entry: 3bze (more details), 2.5 Å
SCOPe Domain Sequences for d3bzed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzed2 b.1.1.2 (D:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d3bzed2: