Lineage for d3bzea2 (3bze A:2-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182988Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 2182992Domain d3bzea2: 3bze A:2-181 [155758]
    Other proteins in same PDB: d3bzea1, d3bzeb2, d3bzeb3, d3bzec1, d3bzed2, d3bzed3, d3bzee1, d3bzef2, d3bzef3, d3bzeg1, d3bzeh2, d3bzeh3
    automatically matched to d1mhea2

Details for d3bzea2

PDB Entry: 3bze (more details), 2.5 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d3bzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzea2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d3bzea2:

Click to download the PDB-style file with coordinates for d3bzea2.
(The format of our PDB-style files is described here.)

Timeline for d3bzea2: