| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
| Domain d3bzea2: 3bze A:2-181 [155758] Other proteins in same PDB: d3bzea1, d3bzeb2, d3bzeb3, d3bzec1, d3bzed2, d3bzed3, d3bzee1, d3bzef2, d3bzef3, d3bzeg1, d3bzeh2, d3bzeh3 automatically matched to d1mhea2 |
PDB Entry: 3bze (more details), 2.5 Å
SCOPe Domain Sequences for d3bzea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzea2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d3bzea2: