Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.13: Tex RuvX-like domain-like [159635] (1 protein) |
Protein Transcriptional accessory factor Tex [159636] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [159637] (3 PDB entries) Uniprot Q9HTY8 325-473 |
Domain d3bzca5: 3bzc A:325-473 [155756] Other proteins in same PDB: d3bzca1, d3bzca2, d3bzca3, d3bzca4 |
PDB Entry: 3bzc (more details), 2.27 Å
SCOPe Domain Sequences for d3bzca5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzca5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} pagpratlgldpglrtgvkvavvdatgklldtatvyphapknqwdqtlavlaalcakhqv eliaigngtasretdklagelikkypgmkltkimvseagasvysaselaakefpeldvsl rgavsiarrlqdplaelvkiepksigvgq
Timeline for d3bzca5:
View in 3D Domains from same chain: (mouse over for more information) d3bzca1, d3bzca2, d3bzca3, d3bzca4 |