Lineage for d3bzca5 (3bzc A:325-473)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837349Family c.55.3.13: Tex RuvX-like domain-like [159635] (1 protein)
  6. 837350Protein Transcriptional accessory factor Tex [159636] (1 species)
  7. 837351Species Pseudomonas aeruginosa [TaxId:287] [159637] (3 PDB entries)
    Uniprot Q9HTY8 325-473
  8. 837353Domain d3bzca5: 3bzc A:325-473 [155756]
    Other proteins in same PDB: d3bzca1, d3bzca2, d3bzca3, d3bzca4

Details for d3bzca5

PDB Entry: 3bzc (more details), 2.27 Å

PDB Description: crystal structure of the tex protein from pseudomonas aeruginosa, crystal form i
PDB Compounds: (A:) Tex

SCOP Domain Sequences for d3bzca5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzca5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
pagpratlgldpglrtgvkvavvdatgklldtatvyphapknqwdqtlavlaalcakhqv
eliaigngtasretdklagelikkypgmkltkimvseagasvysaselaakefpeldvsl
rgavsiarrlqdplaelvkiepksigvgq

SCOP Domain Coordinates for d3bzca5:

Click to download the PDB-style file with coordinates for d3bzca5.
(The format of our PDB-style files is described here.)

Timeline for d3bzca5: