Lineage for d3bzab1 (3bza B:4-147)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409118Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1409119Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1409272Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1409355Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 1409369Species Brevibacterium fuscum [TaxId:47914] [89888] (14 PDB entries)
  8. 1409444Domain d3bzab1: 3bza B:4-147 [155746]
    automated match to d1q0oa1
    complexed with ca, cl, gol, mn

Details for d3bzab1

PDB Entry: 3bza (more details), 1.7 Å

PDB Description: Structure of Mn-substituted Homoprotocatechuate 2,3-Dioxygenase from B.fuscum at 1.7 Ang resolution
PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d3bzab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzab1 d.32.1.3 (B:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

SCOPe Domain Coordinates for d3bzab1:

Click to download the PDB-style file with coordinates for d3bzab1.
(The format of our PDB-style files is described here.)

Timeline for d3bzab1: