![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
![]() | Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
![]() | Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries) |
![]() | Domain d3bz8a1: 3bz8 A:34-79 [155742] automatically matched to d1d0xa1 complexed with adp, bl6, edo, mg, vo4 |
PDB Entry: 3bz8 (more details), 2.2 Å
SCOPe Domain Sequences for d3bz8a1:
Sequence, based on SEQRES records: (download)
>d3bz8a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq
>d3bz8a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} yiwynpdpkerdsyecgeivsetsdsftfktvdqdrqvkkddanq
Timeline for d3bz8a1: