Lineage for d3bz8a1 (3bz8 A:34-79)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783669Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2783670Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2783671Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2783704Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 2783723Domain d3bz8a1: 3bz8 A:34-79 [155742]
    automatically matched to d1d0xa1
    complexed with adp, bl6, edo, mg, vo4

Details for d3bz8a1

PDB Entry: 3bz8 (more details), 2.2 Å

PDB Description: crystal structures of (s)-(-)-blebbistatin analogs bound to dictyostelium discoideum myosin ii
PDB Compounds: (A:) Myosin-2 heavy chain, non muscle

SCOPe Domain Sequences for d3bz8a1:

Sequence, based on SEQRES records: (download)

>d3bz8a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Sequence, based on observed residues (ATOM records): (download)

>d3bz8a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdqdrqvkkddanq

SCOPe Domain Coordinates for d3bz8a1:

Click to download the PDB-style file with coordinates for d3bz8a1.
(The format of our PDB-style files is described here.)

Timeline for d3bz8a1: