![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Lymphocyte kinase (lck) [56153] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56154] (17 PDB entries) |
![]() | Domain d3byua1: 3byu A:231-498 [155733] automatically matched to d1qpca_ complexed with am6 |
PDB Entry: 3byu (more details), 2.3 Å
SCOP Domain Sequences for d3byua1:
Sequence, based on SEQRES records: (download)
>d3byua1 d.144.1.7 (A:231-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely qlmrlcwkerpedrptfdylrsvledff
>d3byua1 d.144.1.7 (A:231-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae gmafieernyihrdlraanilvsdtlsckiadfglkfpikwtapeainygtftiksdvws fgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrp tfdylrsvledff
Timeline for d3byua1: