SCOPe 2.05: Domain d3byra_: 3byr A:

Lineage for d3byra_ (3byr A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families)

5. Family d.52.9.1: Cation efflux protein cytoplasmic domain-like [160241] (2 proteins)
   C=terminal part of Pfam PF01545

6. Protein Putative Zinc transporter CzrB [160242] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160243] (2 PDB entries)
   Uniprot Q8VLX7 203-284

8. Domain d3byra_: 3byr A: [155731]
   automated match to d3bypa1
   complexed with zn

Details for d3byra_

PDB Entry: 3byr, 1.8 Å

PDB Description: mode of action of a putative zinc transporter czrb (zn form)

PDB Compounds: (A:) CzrB protein

SCOPe Domain Sequences for d3byra_:

Sequence; same for both SEQRES and ATOM records:

>d3byra_ d.52.9.1 (A:) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]}
mdeglppeeveriraflqerirgralevhdlktrragprsflefhlvvrgdtpveeahrl
cdeleralaqafpglqatihvepegerkr

Timeline for d3byra_:

• d3byra_ first appeared in SCOP 1.75, called d3byra1
  
• d3byra_ appears in SCOPe 2.04
  
• d3byra_ appears in SCOPe 2.06
  
• d3byra_ appears in the current release, SCOPe 2.08