Lineage for d1a4fb_ (1a4f B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531067Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries)
  8. 531068Domain d1a4fb_: 1a4f B: [15573]
    Other proteins in same PDB: d1a4fa_
    complexed with hem, oxy

Details for d1a4fb_

PDB Entry: 1a4f (more details), 2 Å

PDB Description: bar-headed goose hemoglobin (oxy form)

SCOP Domain Sequences for d1a4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus)}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1a4fb_:

Click to download the PDB-style file with coordinates for d1a4fb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4fa_