Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (22 species) |
Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries) |
Domain d1a4fb_: 1a4f B: [15573] Other proteins in same PDB: d1a4fa_ complexed with hem, oxy |
PDB Entry: 1a4f (more details), 2 Å
SCOP Domain Sequences for d1a4fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus)} vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak eftpdcqaawqklvrvvahalarkyh
Timeline for d1a4fb_: