Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.9: BB2672-like [160519] (1 family) contains extra N-terminal strand and a beta-hairpin insertion between strands 3 and 4 that packs against the main beta-sheet automatically mapped to Pfam PF06684 |
Family d.79.9.1: BB2672-like [160520] (2 proteins) Pam 06684; DUF1185 |
Protein Uncharacterized protein BB2672 [160521] (1 species) |
Species Bordetella bronchiseptica [TaxId:518] [160522] (1 PDB entry) Uniprot Q7WJ28 2-192 |
Domain d3byqa1: 3byq A:2-192 [155728] complexed with cl, edo, pg4 |
PDB Entry: 3byq (more details), 1.7 Å
SCOPe Domain Sequences for d3byqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3byqa1 d.79.9.1 (A:2-192) Uncharacterized protein BB2672 {Bordetella bronchiseptica [TaxId: 518]} slieirkrtlivettyhengpapaqplklaascavirnpyagryepdlmpfmaelrslgt llatelvdtlgkdnievyskaaivgvdgemehgavwheaggwamrsvlgepkamvpavka vatagyrmmvpvhyihasyvrshfnsieigiqdaprpreilfalvmgtgarvharlgglt keavsvhdgqr
Timeline for d3byqa1: