Lineage for d3byqa1 (3byq A:2-192)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1915120Superfamily d.79.9: BB2672-like [160519] (1 family) (S)
    contains extra N-terminal strand and a beta-hairpin insertion between strands 3 and 4 that packs against the main beta-sheet
    automatically mapped to Pfam PF06684
  5. 1915121Family d.79.9.1: BB2672-like [160520] (2 proteins)
    Pam 06684; DUF1185
  6. 1915122Protein Uncharacterized protein BB2672 [160521] (1 species)
  7. 1915123Species Bordetella bronchiseptica [TaxId:518] [160522] (1 PDB entry)
    Uniprot Q7WJ28 2-192
  8. 1915124Domain d3byqa1: 3byq A:2-192 [155728]
    complexed with cl, edo, pg4

Details for d3byqa1

PDB Entry: 3byq (more details), 1.7 Å

PDB Description: crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution
PDB Compounds: (A:) Uncharacterized protein DUF1185

SCOPe Domain Sequences for d3byqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byqa1 d.79.9.1 (A:2-192) Uncharacterized protein BB2672 {Bordetella bronchiseptica [TaxId: 518]}
slieirkrtlivettyhengpapaqplklaascavirnpyagryepdlmpfmaelrslgt
llatelvdtlgkdnievyskaaivgvdgemehgavwheaggwamrsvlgepkamvpavka
vatagyrmmvpvhyihasyvrshfnsieigiqdaprpreilfalvmgtgarvharlgglt
keavsvhdgqr

SCOPe Domain Coordinates for d3byqa1:

Click to download the PDB-style file with coordinates for d3byqa1.
(The format of our PDB-style files is described here.)

Timeline for d3byqa1: