SCOP 1.75: Domain d3bypb1: 3byp B:6-87

Lineage for d3bypb1 (3byp B:6-87)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (1 family)

5. Family d.52.9.1: Cation efflux protein cytoplasmic domain-like [160241] (2 proteins)
   C=terminal part of Pfam PF01545

6. Protein Putative Zinc transporter CzrB [160242] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160243] (2 PDB entries)
   Uniprot Q8VLX7 203-284

8. Domain d3bypb1: 3byp B:6-87 [155727]
   automatically matched to 3BYP A:6-87
   complexed with so4

Details for d3bypb1

PDB Entry: 3byp, 1.7 Å

PDB Description: Mode of Action of a Putative Zinc Transporter CzrB

PDB Compounds: (B:) CzrB protein

SCOP Domain Sequences for d3bypb1:

Sequence; same for both SEQRES and ATOM records:

>d3bypb1 d.52.9.1 (B:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]}
glppeeveriraflqerirgralevhdlktrragprsflefhlvvrgdtpveeahrlcde
leralaqafpglqatihvepeg

Timeline for d3bypb1:

• d3bypb1 is new in SCOP 1.75
  
• d3bypb1 is called d3bypb_ in SCOPe 2.01
  
• d3bypb1 appears in the current release, SCOPe 2.08, called d3bypb_