SCOPe 2.08: Domain d3bypa1: 3byp A:6-87

Lineage for d3bypa1 (3byp A:6-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families)

5. Family d.52.9.1: Cation efflux protein cytoplasmic domain-like [160241] (2 proteins)
   C=terminal part of Pfam PF01545

6. Protein Putative Zinc transporter CzrB [160242] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160243] (2 PDB entries)
   Uniprot Q8VLX7 203-284

8. Domain d3bypa1: 3byp A:6-87 [155726]
   complexed with so4

Details for d3bypa1

PDB Entry: 3byp, 1.7 Å

PDB Description: Mode of Action of a Putative Zinc Transporter CzrB

PDB Compounds: (A:) CzrB protein

SCOPe Domain Sequences for d3bypa1:

Sequence; same for both SEQRES and ATOM records:

>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]}
glppeeveriraflqerirgralevhdlktrragprsflefhlvvrgdtpveeahrlcde
leralaqafpglqatihvepeg

Timeline for d3bypa1:

• d3bypa1 first appeared in SCOP 1.75
  
• d3bypa1 appears in SCOPe 2.07