Lineage for d3bypa1 (3byp A:6-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947485Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families) (S)
  5. 2947486Family d.52.9.1: Cation efflux protein cytoplasmic domain-like [160241] (2 proteins)
    C=terminal part of Pfam PF01545
  6. 2947491Protein Putative Zinc transporter CzrB [160242] (1 species)
  7. 2947492Species Thermus thermophilus [TaxId:274] [160243] (2 PDB entries)
    Uniprot Q8VLX7 203-284
  8. 2947493Domain d3bypa1: 3byp A:6-87 [155726]
    complexed with so4

Details for d3bypa1

PDB Entry: 3byp (more details), 1.7 Å

PDB Description: Mode of Action of a Putative Zinc Transporter CzrB
PDB Compounds: (A:) CzrB protein

SCOPe Domain Sequences for d3bypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]}
glppeeveriraflqerirgralevhdlktrragprsflefhlvvrgdtpveeahrlcde
leralaqafpglqatihvepeg

SCOPe Domain Coordinates for d3bypa1:

Click to download the PDB-style file with coordinates for d3bypa1.
(The format of our PDB-style files is described here.)

Timeline for d3bypa1: