Lineage for d3byna1 (3byn A:34-473)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134549Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1134555Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 1134615Family b.67.2.2: Levansucrase [101881] (1 protein)
  6. 1134616Protein Levansucrase [101882] (2 species)
  7. 1134635Species Bacillus subtilis [TaxId:1423] [101883] (4 PDB entries)
  8. 1134637Domain d3byna1: 3byn A:34-473 [155725]
    automatically matched to d1pt2a_
    complexed with ca, raf; mutant

Details for d3byna1

PDB Entry: 3byn (more details), 2.1 Å

PDB Description: crystal structure of b. subtilis levansucrase mutant e342a bound to raffinose
PDB Compounds: (A:) Levansucrase

SCOPe Domain Sequences for d3byna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byna1 b.67.2.2 (A:34-473) Levansucrase {Bacillus subtilis [TaxId: 1423]}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltvnk

SCOPe Domain Coordinates for d3byna1:

Click to download the PDB-style file with coordinates for d3byna1.
(The format of our PDB-style files is described here.)

Timeline for d3byna1: