Lineage for d3byma_ (3bym A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588329Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2588330Species Human (Homo sapiens) [TaxId:9606] [56154] (34 PDB entries)
  8. 2588343Domain d3byma_: 3bym A: [155724]
    automated match to d1qpca_
    complexed with am0, so4

Details for d3byma_

PDB Entry: 3bym (more details), 2 Å

PDB Description: X-ray co-crystal structure aminobenzimidazole triazine 1 bound to Lck
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d3byma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byma_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
qkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaea
nlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqia
egmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtap
eainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeel
yqlmrlcwkerpedrptfdylrsvledfftat

SCOPe Domain Coordinates for d3byma_:

Click to download the PDB-style file with coordinates for d3byma_.
(The format of our PDB-style files is described here.)

Timeline for d3byma_: