Lineage for d3byma1 (3bym A:231-498)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874916Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 874917Species Human (Homo sapiens) [TaxId:9606] [56154] (17 PDB entries)
  8. 874923Domain d3byma1: 3bym A:231-498 [155724]
    automatically matched to d1qpca_
    complexed with am0, so4

Details for d3byma1

PDB Entry: 3bym (more details), 2 Å

PDB Description: X-ray co-crystal structure aminobenzimidazole triazine 1 bound to Lck
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOP Domain Sequences for d3byma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byma1 d.144.1.7 (A:231-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledff

SCOP Domain Coordinates for d3byma1:

Click to download the PDB-style file with coordinates for d3byma1.
(The format of our PDB-style files is described here.)

Timeline for d3byma1: