Lineage for d3byla1 (3byl A:34-473)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807084Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 807090Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 807143Family b.67.2.2: Levansucrase [101881] (1 protein)
  6. 807144Protein Levansucrase [101882] (1 species)
  7. 807145Species Bacillus subtilis [TaxId:1423] [101883] (4 PDB entries)
  8. 807148Domain d3byla1: 3byl A:34-473 [155723]
    automatically matched to d1pt2a_
    mutant

Details for d3byla1

PDB Entry: 3byl (more details), 2.1 Å

PDB Description: Crystal structure of B. subtilis levansucrase mutant E342A
PDB Compounds: (A:) Levansucrase

SCOP Domain Sequences for d3byla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byla1 b.67.2.2 (A:34-473) Levansucrase {Bacillus subtilis [TaxId: 1423]}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltvnk

SCOP Domain Coordinates for d3byla1:

Click to download the PDB-style file with coordinates for d3byla1.
(The format of our PDB-style files is described here.)

Timeline for d3byla1: