Lineage for d3byla_ (3byl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064867Family b.67.2.2: Levansucrase [101881] (1 protein)
    automatically mapped to Pfam PF02435
  6. 2064868Protein Levansucrase [101882] (2 species)
  7. 2064887Species Bacillus subtilis [TaxId:1423] [101883] (6 PDB entries)
  8. 2064892Domain d3byla_: 3byl A: [155723]
    automated match to d3byja_
    mutant

Details for d3byla_

PDB Entry: 3byl (more details), 2.1 Å

PDB Description: Crystal structure of B. subtilis levansucrase mutant E342A
PDB Compounds: (A:) Levansucrase

SCOPe Domain Sequences for d3byla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byla_ b.67.2.2 (A:) Levansucrase {Bacillus subtilis [TaxId: 1423]}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltvnk

SCOPe Domain Coordinates for d3byla_:

Click to download the PDB-style file with coordinates for d3byla_.
(The format of our PDB-style files is described here.)

Timeline for d3byla_: