SCOP 1.75: Domain d3bxha1: 3bxh A:93-338

Lineage for d3bxha1 (3bxh A:93-338)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families)

5. Family c.124.1.8: SorC sugar-binding domain-like [159545] (5 proteins)
   Pfam PF04198

6. Protein Central glycolytic gene regulator CggR [159554] (1 species)
   formerly hypothetical protein YvbQ

7. Species Bacillus subtilis [TaxId:1423] [159555] (5 PDB entries)
   Uniprot O32253 89-338

8. Domain d3bxha1: 3bxh A:93-338 [155714]
   automatically matched to 2OKG A:89-338
   complexed with f6p, scn

Details for d3bxha1

PDB Entry: 3bxh, 1.85 Å

PDB Description: crystal structure of effector binding domain of central glycolytic gene regulator (cggr) from bacillus subtilis in complex with fructose-6-phosphate

PDB Compounds: (A:) Central glycolytic gene regulator

SCOP Domain Sequences for d3bxha1:

Sequence; same for both SEQRES and ATOM records:

>d3bxha1 c.124.1.8 (A:93-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]}
gltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavtggtt
ieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpgqlsq
gayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteafg
yyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvtdega
akkllr

Timeline for d3bxha1:

• d3bxha1 is new in SCOP 1.75
  
• d3bxha1 appears in SCOPe 2.01
  
• d3bxha1 appears in the current release, SCOPe 2.08, called d3bxha_