![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 proteins) Pfam PF04198 |
![]() | Protein Central glycolytic gene regulator CggR [159554] (1 species) formerly hypothetical protein YvbQ |
![]() | Species Bacillus subtilis [TaxId:1423] [159555] (5 PDB entries) Uniprot O32253 89-338 |
![]() | Domain d3bxha_: 3bxh A: [155714] Other proteins in same PDB: d3bxhb3 automated match to d2okga1 protein/DNA complex; complexed with f6p, scn |
PDB Entry: 3bxh (more details), 1.85 Å
SCOPe Domain Sequences for d3bxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bxha_ c.124.1.8 (A:) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]} gltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavtggtt ieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpgqlsq gayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteafg yyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvtdega akkllrde
Timeline for d3bxha_: