Lineage for d3bxha_ (3bxh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493292Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2493293Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2493549Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 protein domains)
    Pfam PF04198
  6. 2493550Protein Central glycolytic gene regulator CggR [159554] (1 species)
    formerly hypothetical protein YvbQ
  7. 2493551Species Bacillus subtilis [TaxId:1423] [159555] (5 PDB entries)
    Uniprot O32253 89-338
  8. 2493556Domain d3bxha_: 3bxh A: [155714]
    Other proteins in same PDB: d3bxhb3
    automated match to d2okga1
    protein/DNA complex; complexed with f6p, scn

Details for d3bxha_

PDB Entry: 3bxh (more details), 1.85 Å

PDB Description: Crystal structure of effector binding domain of central glycolytic gene regulator (CggR) from Bacillus subtilis in complex with fructose-6-phosphate
PDB Compounds: (A:) Central glycolytic gene regulator

SCOPe Domain Sequences for d3bxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bxha_ c.124.1.8 (A:) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]}
gltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavtggtt
ieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpgqlsq
gayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteafg
yyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvtdega
akkllrde

SCOPe Domain Coordinates for d3bxha_:

Click to download the PDB-style file with coordinates for d3bxha_.
(The format of our PDB-style files is described here.)

Timeline for d3bxha_: