SCOPe 2.06: Domain d1hbrb_: 1hbr B:

Lineage for d1hbrb_ (1hbr B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46508] (1 PDB entry)

8. Domain d1hbrb_: 1hbr B: [15571]
   Other proteins in same PDB: d1hbra_, d1hbrc_
   complexed with hem

Details for d1hbrb_

PDB Entry: 1hbr, 2.3 Å

PDB Description: r-state form of chicken hemoglobin d

PDB Compounds: (B:) protein (hemoglobin d)

SCOPe Domain Sequences for d1hbrb_:

Sequence; same for both SEQRES and ATOM records:

>d1hbrb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Chicken (Gallus gallus) [TaxId: 9031]}
vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
dftpecqaawqklvrvvahalark

Timeline for d1hbrb_:

• d1hbrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbrb_ appears in SCOPe 2.05
  
• d1hbrb_ appears in SCOPe 2.07
  
• d1hbrb_ appears in the current release, SCOPe 2.08