SCOPe 2.07: Domain d3bxea_: 3bxe A:

Lineage for d3bxea_ (3bxe A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 proteins)
   Pfam PF04198

6. Protein Central glycolytic gene regulator CggR [159554] (1 species)
   formerly hypothetical protein YvbQ

7. Species Bacillus subtilis [TaxId:1423] [159555] (5 PDB entries)
   Uniprot O32253 89-338

8. Domain d3bxea_: 3bxe A: [155708]
   Other proteins in same PDB: d3bxeb3
   automated match to d2okga1
   protein/DNA complex; complexed with 13p

Details for d3bxea_

PDB Entry: 3bxe, 1.8 Å

PDB Description: Crystal structure of effector binding domain of central glycolytic gene regulator (CggR) from Bacillus subtilis in complex with dihydroxyacetone phosphate

PDB Compounds: (A:) Central glycolytic gene regulator

SCOPe Domain Sequences for d3bxea_:

Sequence; same for both SEQRES and ATOM records:

>d3bxea_ c.124.1.8 (A:) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]}
gltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavtggtt
ieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpgqlsq
gayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteafg
yyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvtdega
akkllrde

Timeline for d3bxea_:

• d3bxea_ first appeared in SCOP 1.75, called d3bxea1
  
• d3bxea_ appears in SCOPe 2.06
  
• d3bxea_ appears in the current release, SCOPe 2.08