Lineage for d3bxda1 (3bxd A:28-285)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780447Family a.211.1.4: MioX-like [140769] (1 protein)
    Pfam PF05153; DUF706
  6. 780448Protein Myo-inositol oxygenase MioX [140770] (2 species)
  7. 780452Species Mouse (Mus musculus) [TaxId:10090] [140772] (2 PDB entries)
    Uniprot Q9QXN5 28-285
  8. 780453Domain d3bxda1: 3bxd A:28-285 [155707]
    automatically matched to d2huoa1
    complexed with fe, fmt, ins, oh

Details for d3bxda1

PDB Entry: 3bxd (more details), 2 Å

PDB Description: crystal structure of mouse myo-inositol oxygenase (re-refined)
PDB Compounds: (A:) Inositol oxygenase

SCOP Domain Sequences for d3bxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bxda1 a.211.1.4 (A:28-285) Myo-inositol oxygenase MioX {Mouse (Mus musculus) [TaxId: 10090]}
frnytsgplldrvfttyklmhthqtvdfvsrkriqygsfsykkmtimeavgmlddlvdes
dpdvdfpnsfhafqtaegirkahpdkdwfhlvgllhdlgkimalwgepqwavvgdtfpvg
crpqasvvfcdstfqdnpdlqdprystelgmyqphcglenvlmswghdeylyqmmkfnkf
slpseafymirfhsfypwhtggdyrqlcsqqdldmlpwvqefnkfdlytkcpdlpdvesl
rpyyqglidkycpgtlsw

SCOP Domain Coordinates for d3bxda1:

Click to download the PDB-style file with coordinates for d3bxda1.
(The format of our PDB-style files is described here.)

Timeline for d3bxda1: