![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.4: MioX-like [140769] (1 protein) Pfam PF05153; DUF706 |
![]() | Protein Myo-inositol oxygenase MioX [140770] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140772] (2 PDB entries) Uniprot Q9QXN5 28-285 |
![]() | Domain d3bxda_: 3bxd A: [155707] automated match to d2huoa1 complexed with fe, fmt, ins, oh |
PDB Entry: 3bxd (more details), 2 Å
SCOPe Domain Sequences for d3bxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bxda_ a.211.1.4 (A:) Myo-inositol oxygenase MioX {Mouse (Mus musculus) [TaxId: 10090]} frnytsgplldrvfttyklmhthqtvdfvsrkriqygsfsykkmtimeavgmlddlvdes dpdvdfpnsfhafqtaegirkahpdkdwfhlvgllhdlgkimalwgepqwavvgdtfpvg crpqasvvfcdstfqdnpdlqdprystelgmyqphcglenvlmswghdeylyqmmkfnkf slpseafymirfhsfypwhtggdyrqlcsqqdldmlpwvqefnkfdlytkcpdlpdvesl rpyyqglidkycpgtlsw
Timeline for d3bxda_: