![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily) pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368) |
![]() | Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) ![]() automatically mapped to Pfam PF13954 |
![]() | Family b.167.1.1: Usher N-domain [141730] (1 protein) N-terminal part of Pfam PF00577 |
![]() | Protein Outer membrane usher protein FimD [141731] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141732] (4 PDB entries) Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184 |
![]() | Domain d3bwud_: 3bwu D: [155701] Other proteins in same PDB: d3bwuc1, d3bwuc2 automated match to d1ze3d1 complexed with edo, peg |
PDB Entry: 3bwu (more details), 1.76 Å
SCOPe Domain Sequences for d3bwud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bwud_ b.167.1.1 (D:) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]} lyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgiv pcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafms n
Timeline for d3bwud_: