SCOP 1.75: Domain d3bwud1: 3bwu D:2-122

Lineage for d3bwud1 (3bwu D:2-122)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
   pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain ((50346)) and the N-terminal domain of Glutamine synthetase ((54368))
   pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain ((50346)) and the N-terminal domain of Glutamine synthetase (54368))

4. Superfamily b.167.1: FimD N-terminal domain-like [141729] (1 family)

5. Family b.167.1.1: Usher N-domain [141730] (1 protein)
   N-terminal part of Pfam PF00577

6. Protein Outer membrane usher protein FimD [141731] (1 species)

7. Species Escherichia coli [TaxId:562] [141732] (4 PDB entries)
   Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184

8. Domain d3bwud1: 3bwu D:2-122 [155701]
   Other proteins in same PDB: d3bwuc1, d3bwuc2
   automatically matched to d1ze3d1
   complexed with edo, peg

Details for d3bwud1

PDB Entry: 3bwu, 1.76 Å

PDB Description: crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)

PDB Compounds: (D:) Outer membrane usher protein FimD, N-terminal domain

SCOP Domain Sequences for d3bwud1:

Sequence; same for both SEQRES and ATOM records:

>d3bwud1 b.167.1.1 (D:2-122) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
lyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgiv
pcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafms
n

Timeline for d3bwud1:

• d3bwud1 is new in SCOP 1.75
  
• d3bwud1 is called d3bwud_ in SCOPe 2.01
  
• d3bwud1 appears in the current release, SCOPe 2.08, called d3bwud_