| Class b: All beta proteins [48724] (174 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) ![]() |
| Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
| Protein FimC [49588] (1 species) |
| Species Escherichia coli [TaxId:562] [49589] (6 PDB entries) |
| Domain d3bwuc2: 3bwu C:122-205 [155700] Other proteins in same PDB: d3bwuc1, d3bwud_ automatically matched to d1bf8a2 complexed with edo, peg |
PDB Entry: 3bwu (more details), 1.76 Å
SCOPe Domain Sequences for d3bwuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bwuc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme
Timeline for d3bwuc2: