SCOPe 2.08: Domain d3bwuc2: 3bwu C:122-205

Lineage for d3bwuc2 (3bwu C:122-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (11 PDB entries)

8. Domain d3bwuc2: 3bwu C:122-205 [155700]
   Other proteins in same PDB: d3bwuc1, d3bwud_
   automated match to d1bf8a2
   complexed with edo, peg

Details for d3bwuc2

PDB Entry: 3bwu, 1.76 Å

PDB Description: crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3bwuc2:

Sequence; same for both SEQRES and ATOM records:

>d3bwuc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d3bwuc2:

• d3bwuc2 first appeared in SCOP 1.75
  
• d3bwuc2 appears in SCOPe 2.07