SCOPe 2.05: Domain d1qpwd_: 1qpw D:

Lineage for d1qpwd_ (1qpw D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries)

8. Domain d1qpwd_: 1qpw D: [15570]
   Other proteins in same PDB: d1qpwa_, d1qpwc_
   complexed with hem, oxy

Details for d1qpwd_

PDB Entry: 1qpw, 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

PDB Compounds: (D:) poricine hemoglobin (beta subunit)

SCOPe Domain Sequences for d1qpwd_:

Sequence; same for both SEQRES and ATOM records:

>d1qpwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

Timeline for d1qpwd_:

• d1qpwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpwd_ appears in SCOPe 2.04
  
• d1qpwd_ appears in SCOPe 2.06
  
• d1qpwd_ appears in the current release, SCOPe 2.08