Lineage for d1qpwd_ (1qpw D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632750Species Pig (Sus scrofa) [TaxId:9823] [46507] (2 PDB entries)
  8. 632752Domain d1qpwd_: 1qpw D: [15570]
    Other proteins in same PDB: d1qpwa_, d1qpwc_
    complexed with hem, o2

Details for d1qpwd_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution
PDB Compounds: (D:) poricine hemoglobin (beta subunit)

SCOP Domain Sequences for d1qpwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

SCOP Domain Coordinates for d1qpwd_:

Click to download the PDB-style file with coordinates for d1qpwd_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwd_: