SCOP 1.67: Domain d1qpwd_: 1qpw D:

Lineage for d1qpwd_ (1qpw D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (19 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46507] (2 PDB entries)

8. Domain d1qpwd_: 1qpw D: [15570]
   Other proteins in same PDB: d1qpwa_, d1qpwc_
   complexed with hem, o2

Details for d1qpwd_

PDB Entry: 1qpw, 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

SCOP Domain Sequences for d1qpwd_:

Sequence; same for both SEQRES and ATOM records:

>d1qpwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa)}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

Timeline for d1qpwd_:

• d1qpwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpwd_ appears in SCOP 1.65
  
• d1qpwd_ appears in SCOP 1.69
  
• d1qpwd_ appears in the current release, SCOPe 2.08