Lineage for d1qpwd_ (1qpw D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 471Species Pig (Sus scrofa) [TaxId:9823] [46507] (2 PDB entries)
  8. 473Domain d1qpwd_: 1qpw D: [15570]
    Other proteins in same PDB: d1qpwa_, d1qpwc_

Details for d1qpwd_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

SCOP Domain Sequences for d1qpwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa)}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

SCOP Domain Coordinates for d1qpwd_:

Click to download the PDB-style file with coordinates for d1qpwd_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwd_: