Lineage for d1qpwd_ (1qpw D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687757Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries)
  8. 2687759Domain d1qpwd_: 1qpw D: [15570]
    Other proteins in same PDB: d1qpwa_, d1qpwc_
    complexed with hem, oxy

Details for d1qpwd_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution
PDB Compounds: (D:) porcine hemoglobin (beta subunit)

SCOPe Domain Sequences for d1qpwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

SCOPe Domain Coordinates for d1qpwd_:

Click to download the PDB-style file with coordinates for d1qpwd_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwd_: