![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
![]() | Protein Periplasmic chaperone FimC [49358] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49359] (9 PDB entries) |
![]() | Domain d3bwuc1: 3bwu C:1-121 [155699] Other proteins in same PDB: d3bwuc2, d3bwud_ automated match to d1bf8a1 complexed with edo, peg |
PDB Entry: 3bwu (more details), 1.76 Å
SCOPe Domain Sequences for d3bwuc1:
Sequence, based on SEQRES records: (download)
>d3bwuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
>d3bwuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdentlqlaiisriklyyrpakla
Timeline for d3bwuc1: