Lineage for d3bwuc1 (3bwu C:1-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031706Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2031707Family b.1.11.1: Pilus chaperone [49355] (6 protein domains)
    automatically mapped to Pfam PF00345
  6. 2031725Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 2031726Species Escherichia coli [TaxId:562] [49359] (8 PDB entries)
  8. 2031727Domain d3bwuc1: 3bwu C:1-121 [155699]
    Other proteins in same PDB: d3bwuc2, d3bwud_
    automated match to d1bf8a1
    complexed with edo, peg

Details for d3bwuc1

PDB Entry: 3bwu (more details), 1.76 Å

PDB Description: crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3bwuc1:

Sequence, based on SEQRES records: (download)

>d3bwuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Sequence, based on observed residues (ATOM records): (download)

>d3bwuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdentlqlaiisriklyyrpakla

SCOPe Domain Coordinates for d3bwuc1:

Click to download the PDB-style file with coordinates for d3bwuc1.
(The format of our PDB-style files is described here.)

Timeline for d3bwuc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bwuc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bwud_