SCOPe 2.08: Domain d3bwgc2: 3bwg C:89-233

Lineage for d3bwgc2 (3bwg C:89-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.2: UTRA domain [143473] (11 proteins)
   Pfam PF07702

6. Protein Transcriptional regulator YydK [160413] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160414] (1 PDB entry)
   Uniprot Q45591 89-233

8. Domain d3bwgc2: 3bwg C:89-233 [155698]
   Other proteins in same PDB: d3bwga1, d3bwgb1, d3bwgc1
   automated match to d3bwga2
   complexed with edo

Details for d3bwgc2

PDB Entry: 3bwg, 2.09 Å

PDB Description: The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (C:) Uncharacterized HTH-type transcriptional regulator yydK

SCOPe Domain Sequences for d3bwgc2:

Sequence; same for both SEQRES and ATOM records:

>d3bwgc2 d.190.1.2 (C:89-233) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}
dfnvtskvieldvrkptpeaaenlnigmdediyyvkrvryingqtlcyeesyytksivty
lnneivshsifhyireglglkigfsdlflhvgqlneeeaeylgleaglpklyiesifhlt
ngqpfdyskisynyeqsqfvvqans

Timeline for d3bwgc2:

• d3bwgc2 first appeared in SCOP 1.75
  
• d3bwgc2 appears in SCOPe 2.07