Lineage for d3bwga2 (3bwg A:89-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005715Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 3005716Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 3005731Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 3005773Protein Transcriptional regulator YydK [160413] (1 species)
  7. 3005774Species Bacillus subtilis [TaxId:1423] [160414] (1 PDB entry)
    Uniprot Q45591 89-233
  8. 3005775Domain d3bwga2: 3bwg A:89-233 [155694]
    Other proteins in same PDB: d3bwga1, d3bwgb1, d3bwgc1
    complexed with edo

Details for d3bwga2

PDB Entry: 3bwg (more details), 2.09 Å

PDB Description: The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (A:) Uncharacterized HTH-type transcriptional regulator yydK

SCOPe Domain Sequences for d3bwga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwga2 d.190.1.2 (A:89-233) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}
dfnvtskvieldvrkptpeaaenlnigmdediyyvkrvryingqtlcyeesyytksivty
lnneivshsifhyireglglkigfsdlflhvgqlneeeaeylgleaglpklyiesifhlt
ngqpfdyskisynyeqsqfvvqans

SCOPe Domain Coordinates for d3bwga2:

Click to download the PDB-style file with coordinates for d3bwga2.
(The format of our PDB-style files is described here.)

Timeline for d3bwga2: