Lineage for d3bwef1 (3bwe F:1003-1188)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826867Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 826986Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 826987Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 826988Species Human (Homo sapiens) [TaxId:9606] [89604] (12 PDB entries)
    Uniprot Q99497
  8. 827016Domain d3bwef1: 3bwe F:1003-1188 [155691]
    automatically matched to d1pdwg_
    complexed with po4

Details for d3bwef1

PDB Entry: 3bwe (more details), 2.4 Å

PDB Description: Crystal structure of aggregated form of DJ1
PDB Compounds: (F:) Protein DJ-1

SCOP Domain Sequences for d3bwef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwef1 c.23.16.2 (F:1003-1188) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
skralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasledak
kegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgsk
vtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqvk
aplvlk

SCOP Domain Coordinates for d3bwef1:

Click to download the PDB-style file with coordinates for d3bwef1.
(The format of our PDB-style files is described here.)

Timeline for d3bwef1: