SCOPe 2.01: Domain d3bwaa2: 3bwa A:1-181

Lineage for d3bwaa2 (3bwa A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)

8. Domain d3bwaa2: 3bwa A:1-181 [155684]
   Other proteins in same PDB: d3bwaa1, d3bwab_
   automatically matched to d1a1ma2

Details for d3bwaa2

PDB Entry: 3bwa, 1.3 Å

PDB Description: crystal structure of hla b*3508 in complex with a hcmv 8-mer peptide from the pp65 protein

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3bwaa2:

Sequence; same for both SEQRES and ATOM records:

>d3bwaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq
r

Timeline for d3bwaa2:

• d3bwaa2 first appeared in SCOP 1.75
  
• d3bwaa2 appears in SCOPe 2.02
  
• d3bwaa2 appears in the current release, SCOPe 2.08